Domain assignment for gi|387627330|ref|YP_006063506.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
58 149 Ribosomal protein L9 C-domain 9.68e-23 Ribosomal protein L9 C-domain 0.0002 1div A:56-149 Alignments
1 56 L9 N-domain-like 0.00000000000000872 Ribosomal protein L9 N-domain 0.00047 1cqu A: Alignments

Protein Sequence Details

Sequence length 150
Comment 50S ribosomal protein L9 [Streptococcus pneumoniae INV104]
Sequence
MKVIFLADVKGKGKKGEIKEVPTGYAQNFLIKKNLAKEATAQAVGELRGKQKSEEKAHAEMIAEGKAIKAQLEAEETVVEFVEKVGPDGRTFGSITNKKIAEELQKQFGIKIDKRHIQVQAPIRAVGLIDVPVKIYQDITSVINLRVKEG

Download

Sequence (FASTA)