Domain assignment for gi|387627326|ref|YP_006063502.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 94 MTH1187/YkoF-like 1.7e-25 MTH1187-like 0.0000111 2ibo A:1-90 Alignments

Protein Sequence Details

Sequence length 96
Comment hypothetical protein INV104_19010 [Streptococcus pneumoniae INV104]
Sequence
MKASIALQVLPLAQGIDRIAVIDQVIAYLQTQEVTMVVTPFETVLEGEFDELMRILKEALEVAGQEADNVFANVKINVGEILSIDEKLEKYTETTH

Download

Sequence (FASTA)