Domain assignment for gi|387627254|ref|YP_006063430.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
117 578 Class II aaRS and biotin synthetases 1.17e-103 Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000836 1g51 A:105-294,A:415-580 Alignments
292 414 GAD domain-like 1.28e-36 GAD domain 0.00044 1g51 A:295-414 Alignments
2 110 Nucleic acid-binding proteins 3.05e-29 Anticodon-binding domain 0.0000947 1g51 A:1-104 Alignments

Protein Sequence Details

Sequence length 587
Comment aspartyl-tRNA synthetase [Streptococcus pneumoniae INV104]
Sequence
MKRSMYAGRVREEHIGQEITLKGWVGRRRDLGGLIFIDLRDREGIMQLVINPEKVSAEVMATAESLRSEFVIEVTGQVAAREQANDKLPTGTVELNVTALIVLNTAKTTPFEIKDGIEANDDTRLRYRYLDLRRPEMLENLKLRAKVTHSIRNYLDELEFIDVETPFLSKSTPEGARDYLVPSRVNKGHFYALPQSPQITKQLLMNAGFDRYYQIVKCFRDEDLRGDRQPEFTQVDLETSFLTEQEIQDITEGLIARVMKETKGIEVTLPFPRMKYDDAMALYGSDKPDTRFDMLLQDLTEVVKGVDFKVFSEAPAVKAIVVKEAADNYSRKDIDKMTEVAKQYGAKGLAWVKVVDGELNGPVAKFLTGIQEELTTALALEDKDLVFFVADTLEVANATLGALRGRIAKELGLIDNDKFNFLWVVDWPMFEWSEEEGRYMSAHHPFTLPQEETVHELEGDLAKVRAIAYDIVLNGYELGGGSLRINQKDLQERMFKALGFSTEEANDQFGFLLEAMDYGFPPHGGLAIGLDRFVMLLAGEENIREVIAFPKNNKATDPMTQAPSTVALKQLEELSLQVEEDETNKTN

Download

Sequence (FASTA)