Domain assignment for gi|387627238|ref|YP_006063414.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
84 218 Trimeric LpxA-like enzymes 7.72e-48 Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD 0.012 1tdt A: Alignments

Protein Sequence Details

Sequence length 232
Comment putative transferase [Streptococcus pneumoniae INV104]
Sequence
MTATKMNAQEIIQFIANAEKKTSVKVTFEGQLATAVPSSVVKLGNVLFGDWKDVAPLLEGLVENQDYVVEQDARNSAVPLLDKRAINARIEPGAIIRDQVEIGDNAVIMMGAVINIGAEIGAGTMIDMGAILGGRAIVGKNSHVGAGAVLAGVIEPASAEPVCVGDNVLIGANAVVIEGVQIGSGSVVAAGAIVTQDVPENVVVAGVPARIIKEIDAQTQQKTALEDALRTL

Download

Sequence (FASTA)