Domain assignment for gi|387627231|ref|YP_006063407.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 210 PhoU-like 2.07e-66 SCOPe 0.0000000819 2i0m A: Alignments

Protein Sequence Details

Sequence length 216
Comment phosphate transport system protein [Streptococcus pneumoniae INV104]
Sequence
MRNQFDLELHELEQSFLGLGQLVLETASKALLALASKDKEMAELIINKDHAINQGQSAIELTCARLLALQQPQVSDLRFVISIMSSCSDLERMGDHMAGIAKAVLQLKENQLAPDEEQLHQMGKLSLSMLADLLVAFPLHQASKAISIAQKDEQIDQYYYALSKEIIGLMKDQETSIPNGTQYLYIIGHLERFADYIANICERLVYLETGELVDLN

Download

Sequence (FASTA)