Domain assignment for gi|387627225|ref|YP_006063401.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 125 CheY-like 1.99e-42 CheY-related 0.0000376 1mvo A: Alignments
132 232 C-terminal effector domain of the bipartite response regulators 2.52e-31 PhoB-like 0.00077 1ys7 A:128-233 Alignments

Protein Sequence Details

Sequence length 235
Comment alkaline phosphatase synthesis transcriptional regulatory protein [Streptococcus pneumoniae INV104]
Sequence
MTKQVLLVDDEEHILKLLDYHLSKEGFSTQLVTNGRKALALAETEPFDFILLDIMLPQLDGMEVCKRLRAKGVKTPIMMVSAKSDEFDKVLALELGADDYLTKPFSPRELLARVKAVLRRTKGEQEGDDSDNIADDSWLFGTLKVYPERHEVYKANKLLSLTPKEFELLLYLMKHPNMTLTRERLLERIWGYDFGQETRLVDVHIGKLREKIEDNPKAPQFIRTIRGYGYKFKEL

Download

Sequence (FASTA)