Domain assignment for gi|387627214|ref|YP_006063390.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
15 421 Glutamine synthetase/guanido kinase 2.45e-44 Glutamate-cysteine ligase family 2 (GCS2) 0.011 1tt4 A: Alignments

Protein Sequence Details

Sequence length 425
Comment hypothetical protein INV104_17830 [Streptococcus pneumoniae INV104]
Sequence
MSCSIDLLKHRYLKNIKENPELFVGIELEYPVASLEGDATDVEVIKDLFHYLVSTLDLTVAKVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQRKLAESNHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTFICGSQVQLDISKTNYLRVINAFTQIEAAKAYLFANSEFSGADWDTKISRDIFWEESMHGIYPENVGVNARLLNDEADFFDYLNHSAIFTAERDGQTYYFYPIQAGDYLATSEIQAFALNGDEVIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVNLDKLEAYLETAPFFKVFGYDYKSLRRQFSKKNLTDEEETTIIEFSKDLLLLAEEGLVVRNKEEMTYLQPLREELSL

Download

Sequence (FASTA)