Domain assignment for gi|387627207|ref|YP_006063383.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 204 Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 7.72e-70 Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.00000147 1aug A: Alignments

Protein Sequence Details

Sequence length 214
Comment putative pyrrolidone-carboxylate peptidase [Streptococcus pneumoniae INV104]
Sequence
MKVLVTGFEPFGGEKGNPTLEAIKGLPAEIHGAEVRWLEVPTVFHKSAQVLEEEMNRYQPDFVLCIGQAGGRTSVTLERVAINQDDARISDNEDNQPIDRPIRPDGASAYFSSLPIKAMVQAIKKEGLPASVSNTAGTFVCSHLMYQALYLVEKKFPYVKAGFMHIPYMMEQVVNRPTTPTMSLVDIRRGIEAAIGAMIEHGDQELKLVGGETH

Download

Sequence (FASTA)