Domain assignment for gi|387627160|ref|YP_006063336.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
6 117 N-utilization substance G protein NusG, N-terminal domain 6.41e-36 N-utilization substance G protein NusG, N-terminal domain 0.00012 1nz8 A: Alignments
124 177 Translation proteins SH3-like domain 0.0000000000013 N-utilization substance G protein NusG, C-terminal domain 0.0043 1nz9 A: Alignments

Protein Sequence Details

Sequence length 178
Comment transcription antitermination factor [Streptococcus pneumoniae INV104]
Sequence
MDSFDKGWFVLQTYSGYENKVKENLLQRAQTYNMLDNILRVEIPTQTVQVEKNGKRKEVEENRFPGYVLVEMVMTDEAWFVVRNTPNVTGFVGSHGNRSKPTPLLEQEIRDILVSMGQTVQEFDFDVEIGQTVRIIDGAFADYTGKITEIDNNKVKMIISMFGNDTVAEVNLNQIAEL

Download

Sequence (FASTA)