Domain assignment for gi|387627155|ref|YP_006063331.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 132 CheY-like 3.7e-31 CheY-related 0.00081 1a04 A:5-142 Alignments
124 199 C-terminal effector domain of the bipartite response regulators 4.76e-20 GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0045 1a04 A:150-216 Alignments

Protein Sequence Details

Sequence length 199
Comment response regulator protein [Streptococcus pneumoniae INV104]
Sequence
MKVLVAEDQSMLRDAMCQLLTLQPDVESVLQAKNGQEAIQLLEKESVDIAILDVEMPVKTGLEVLEWIRSERLETKVVVVTTFKRAGYFERAVKAGVDAYVLKERSIADLMQTLHTVLEGRKEYSPELMEVVMTRPNPLTEQEIAVLKGIARGLSNQEIADQLYLSNGTIRNYVTNILSKLDAGNRTEAANIAKESGWL

Download

Sequence (FASTA)