Domain assignment for gi|387627138|ref|YP_006063314.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 137 Thiamin pyrophosphokinase, catalytic domain 2.09e-32 Thiamin pyrophosphokinase, catalytic domain 0.0022 1ig3 A:10-178 Alignments

Protein Sequence Details

Sequence length 220
Comment putative thiamin pyrophosphokinase [Streptococcus pneumoniae INV104]
Sequence
MSEYKLSENNWTRVAVFAGGDRGHYRTDFDGFVGVDRGSLWILEEDLPLALAVGDFDSVTEEERQVIQKRAQYFVQARPEKDDTDLELALLTIFKQNPQAQVTIFGALGGRIDHMLANVFLPSNPKLASYMHQIEIEDGQNLITYCPEGISQLEPRSDYDYLAFMPVRDSQLTILGAKYELTEENFFFKKVYASNEYIDREVSVTCPDGYVVVLHSKDRR

Download

Sequence (FASTA)