Domain assignment for gi|387627126|ref|YP_006063302.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 159 Nucleotidylyl transferase 1.04e-38 Adenylyltransferase 0.00014 1od6 A: Alignments

Protein Sequence Details

Sequence length 162
Comment phosphopantetheine adenylyltransferase [Streptococcus pneumoniae INV104]
Sequence
MSDKIGLFTGSFDPMTNGHLDIIERASRLFDKLCVGIFFNPHKQGFLPLENRKRGLEKALGHLENVEVVASHDELVVDVAKRLGATCLVRGLRNASDLQYEASFDYYNHQLSSDIETIYLHSRPEHLYISSSGVRELLKFGQDIACYVPESILEEIRNEKKD

Download

Sequence (FASTA)