Domain assignment for gi|387627110|ref|YP_006063286.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
6 168 Acyl-CoA N-acyltransferases (Nat) 4.73e-39 SCOPe 0.000000346 2i79 B: Alignments

Protein Sequence Details

Sequence length 172
Comment acetyltransferase (GNAT) family protein [Streptococcus pneumoniae INV104]
Sequence
MEYELLIREAEPKDAAELVAFLNRVSLETDFTSLDGDGILLTSEEMEIFLNKQASSDNQITLLAFLNGKIAGIVNITADQRKRVRHIGDLFIVIGKRYWNNGLGSLLLEEAIEWAQASGILRRLQLTVQTRNQAAVHLYQKHGFVIEGSQERGAYIEEGKFIDVYLMGKLIG

Download

Sequence (FASTA)