Domain assignment for gi|387627050|ref|YP_006063226.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
45 233 Pseudouridine synthase 1.68e-45 Pseudouridine synthase RsuA/RluD 0.0000826 1ksk A:60-231 Alignments
1 56 Alpha-L RNA-binding motif 2.16e-16 Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain 0.09 1jh3 A: Alignments

Protein Sequence Details

Sequence length 240
Comment ribosomal large subunit pseudouridine synthase B [Streptococcus pneumoniae INV104]
Sequence
MRINKYIAHAGVASRRKAEELIKQGLVTVNGQVVRELATTIKSGDKVEVEGQPIYNEEKVYYLLNKPRGVISSVTDDKGRKTVVDLLPNVKERIYPVGRLDWDTSGVLILTNDGDFTDEMIHPRNEIDKVYVARVKGVANKDNLRPLTRGLEIDGKKTKPAVYEILKVDPVKNRSVVQLTIHEGRNHQVKKMFEAVGLQVDKLSRTRFGHLDLTGLRPGESRRLNKKEISQLHTMAVTKK

Download

Sequence (FASTA)