Domain assignment for gi|387627043|ref|YP_006063219.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
5 351 Zn-dependent exopeptidases 7.33e-58 Bacterial dinuclear zinc exopeptidases 0.000017 1vhe A:3-72,A:163-367 Alignments
71 181 Aminopeptidase/glucanase lid domain 8.7e-26 Aminopeptidase/glucanase lid domain 0.00055 1vhe A:73-162 Alignments

Protein Sequence Details

Sequence length 354
Comment putative glutamyl-aminopeptidase [Streptococcus pneumoniae INV104]
Sequence
MTTLFSKIKEVTELAAVSGHEAPVRAYLREKLTPHVDEVVTDGLGGIFGIKHSEAVDAPRVLVASHMDEVGFMVSEIKPDGTFRVVEIGGWNPMVVSSQRFKLLTRDGHEIPVISGSVPPHLTRGKGGPTMPAIADIVFDGGFADKAEAESFGIRPGDTIVPDSSAILTANEKNIISKAWDNRYGVLMVSELAEALSGQKLGNELYLGSNVQEEVGLRGAHTSTTKFDPEVFLAVDCSPAGDVYGGQGKIGDGTLIRFYDPGHLLLPGMKDFLLTTAEEAGIKYQYYCGKGGTDAGAAHLKNGGVPSTTIGVCARYIHSHQTLYAMDDFLEAQAFLQALVKKLDRSTVDLIKHY

Download

Sequence (FASTA)