Domain assignment for gi|387627034|ref|YP_006063210.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 114 Putative DNA-binding domain 1.17e-29 DNA-binding N-terminal domain of transcription activators 0.0053 1jbg A: Alignments

Protein Sequence Details

Sequence length 117
Comment MerR family transcriptional regulator [Streptococcus pneumoniae INV104]
Sequence
MNIKSASDLLGISADTIRYYERVGLVPPITRTATGIRDFQDQDIEALEFIKCFRSAGVSVDSLVDYMSLYQKGDETREERLGILEEEKQKLEERLSQLQTALNRLNLKIKLYKEGKF

Download

Sequence (FASTA)