Domain assignment for gi|387627031|ref|YP_006063207.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
6 207 Ribosomal protein S5 domain 2-like 4.17e-61 GHMP Kinase, N-terminal domain 0.000000831 1pie A:9-213 Alignments
210 390 GHMP Kinase, C-terminal domain 3.45e-56 Galactokinase 0.00000391 1pie A:214-396 Alignments

Protein Sequence Details

Sequence length 392
Comment galactokinase [Streptococcus pneumoniae INV104]
Sequence
MAQHLTTEALRKDFLAVFGQEADQTFFSPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADLKFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGLSSSASLELLTGVVAEHLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLDLKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAVDQYSYLIKDENRLKRARHAVFENQRTLKAQAALQAGDLETFGRLMNASHVSLEHDYEVTGLELDTLVHTAWAQEGVLGARMTGAGFGGCAIALVQKDTVEAFKEAVGKHYEEVVGYAPSFYIAEVAGGTRVLD

Download

Sequence (FASTA)