Domain assignment for gi|387627029|ref|YP_006063205.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
8 121 Thioesterase/thiol ester dehydrase-isomerase 2e-28 PaaI/YdiI-like 0.0047 1psu A: Alignments

Protein Sequence Details

Sequence length 134
Comment thioesterase superfamily protein [Streptococcus pneumoniae INV104]
Sequence
MKDFHFDAISAFENYEIEKMRDGHVVVTTKVVNSSLNYYGNAHGGYLFTLCDQISGLVVISLGLDGVTLQSSINYLKAGKLDDVLTIKGECVHQGRTTCVMDVDITNQEGRNVCKATFTMFVTGQRSEERRVRI

Download

Sequence (FASTA)