Domain assignment for gi|387627011|ref|YP_006063187.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 240 P-loop containing nucleoside triphosphate hydrolases 1.59e-81 ABC transporter ATPase domain-like 0.000000678 1v43 A:7-245 Alignments
258 336 MOP-like 0.0000051 BiMOP, duplicated molybdate-binding domain 0.058 1h9m A:74-141 Alignments

Protein Sequence Details

Sequence length 336
Comment putative iron ABC transporter ATP-binding protein [Streptococcus pneumoniae INV104]
Sequence
MIKFDNIQIKYGDFVAIDNLNLDIHEGEFFTFLGPSGCGKSTTLRALVGFLDPSSGSIEVNGTDVTHLEPEKRGIGIVFQSYALFPTMTVFDNIAFGLKVKKVAPDVIKAKVSAVAAKIKISDQQLQRNVSELSGGQQQRVALARALVLEPKILCLDEPLSNLDAKLRVDLRKELKRLQKELGITTLYVTHDQEEALTLSDRIAVFNNGYIEQVGTPVEIYHNSQTEFVCDFIGDINVLTDETVHEVLLKNTSVFLEDKKGYIRLEKVRFNRETEQDFILKGTIIDVEFSGVTIHYTIKVSESQILNVTSIDSQAAIRSVGESVELFITPSDVLQF

Download

Sequence (FASTA)