Domain assignment for gi|387626996|ref|YP_006063172.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
10 134 Acyl-CoA N-acyltransferases (Nat) 4.36e-20 N-acetyl transferase, NAT 0.006 1tiq A: Alignments

Protein Sequence Details

Sequence length 148
Comment GNAT family acetyltransferase [Streptococcus pneumoniae INV104]
Sequence
MTIRFEEKVSIENAQLVCQWSNSLGKVFQEQWMGPRIPFLLTLQALEGVFSIFDEQEFVGLIQKIRLEDSNLHIGRFFINPQKQEQGLGSQALRKFVSLAFENEDIDSISLNVFEANQRAQNLYQKEGFEIVQMVEAPVRKYSRLKLE

Download

Sequence (FASTA)