Domain assignment for gi|387626977|ref|YP_006063153.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
66 265 MetI-like 6.54e-56 MetI-like 0.00026 2r6g F:261-504 Alignments
21 53 MalF N-terminal region-like 0.000000615 MalF N-terminal region-like 0.01 2r6g F:13-260 Alignments

Protein Sequence Details

Sequence length 279
Comment ABC transporter [Streptococcus pneumoniae INV104]
Sequence
MDMSKETVVYTKRREKIKDNILGYSFLAPALILLGIFLVIPVGMVIYYAFTDYYLLTPDERKFVGLENFIRLTKDPIFLKSFLNTLKFVVWIIPVQLGAALGMALIVNKKRKGNMFFKVAFFAPVVMSLVVISILWLYLLNPNSGLLNAILNKVGIASQPFLTSPKQAMYAIVFVSAWQGAGYQMLLFLGGMQNIPQDVYEAAELDGFSKWAQFRYITMPLLKPTALFVLLTTLISAFKLIVQPMVMTQGGPLNSTITMVYYIRLVRNLVHFIIDDGTN

Download

Sequence (FASTA)