Domain assignment for gi|387626957|ref|YP_006063133.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
110 283 Trimeric LpxA-like enzymes 1.08e-29 Galactoside acetyltransferase-like 0.01 1ocx A: Alignments

Protein Sequence Details

Sequence length 292
Comment hypothetical protein INV104_15140 [Streptococcus pneumoniae INV104]
Sequence
MKKNHLVGDALILTVSDQIEELDYLLESLPNICFYIAAPVQFSEKIRSLETNYNVRLRTITNEEQLNFLVDTCDFLLDINHFQEVDAIVSKFVQAGKSVFAFDNTVHGNQGQEVFLSSTPDKLVSRVRDYLNEVRVGTNHQEKIIQDGTWNVFKIDDKAHFIVGANVICRNFENFHVSSGKLILHDGVFINNSCSFNCMERIEIGAGTMMGEGVRFYDHDHIYTAEKIEKWQWTTAPIRVGRDCWIGSNVTILKGVTIGDNTIIGAGCLIRNDIPSNSVVYNNGNLVVKRRD

Download

Sequence (FASTA)