Domain assignment for gi|387626939|ref|YP_006063115.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
23 114 Mechanosensitive channel protein MscS (YggB), transmembrane region 6.8e-17 Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0026 2oau A:27-112 Alignments
116 182 Sm-like ribonucleoproteins 0.000000000239 Mechanosensitive channel protein MscS (YggB), middle domain 0.0043 2oau A:113-179 Alignments

Protein Sequence Details

Sequence length 186
Comment putative mechanosensitive ion channel protein [Streptococcus pneumoniae INV104]
Sequence
MQKFIQAYIEKLDVTTIIENILTKVISLLLLLIVFYIAKKMLHTMVQRIVKPSLKMSRHDVGRQKTISRLLENVFNYTLYFFLLYCILSILGLPVSSLLAGAGIAGVAIGMGAQGFLSDVINGFFILFERQLDVGDEVVLTNGPITVSGKVVSVGIRTTQLRSEEQALHFVPNRNITVVSNFSRTD

Download

Sequence (FASTA)