Domain assignment for gi|387626934|ref|YP_006063110.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
24 209 Nucleotidylyl transferase 7.82e-54 Adenylyltransferase 0.00000538 1kam A: Alignments

Protein Sequence Details

Sequence length 209
Comment putative nicotinate-nucleotide adenylyltransferase [Streptococcus pneumoniae INV104]
Sequence
MTIELLTPFTKVELEPEIKEKKRKQVGILGGNFNPVHNAHLIVADQVRQQLGLDQVLLMPEYQPPHVDKKETIPEHHRLKMLELAIEGIDGLVIETIELERKGISYTYDTMKILTEKNPDTDYYFIIGADMVDYLPKWYRIDELVDMVQFVGVQRPRYKVGTSYPVIWVDVPLMDISSSMVRDFLAQGRKPNFLLPQPVLDYIEKEGLY

Download

Sequence (FASTA)