Domain assignment for gi|387626929|ref|YP_006063105.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
10 211 Nucleotidylyl transferase 5.63e-19 Adenylyltransferase 0.076 1f9a A: Alignments

Protein Sequence Details

Sequence length 365
Comment hypothetical protein INV104_14850 [Streptococcus pneumoniae INV104]
Sequence
MTITGIIAEFNPFHNGHKYLLDQAEGLKIVAMSGNFMQRGEPAIVDKWTRAQMALENGADLVVELPFLVSVQAADFFGQGAVDILDRLGIDSLVFGTEEVLDYQKIADLYTEKGAEMEKFVKNLPDSLSYPQKTQAMWKEFAGLDFSGNTPNHVLALAYAKAVAGRNIKLHPIQRQGAGYHSVNKDVDFASATALRQHQKDQDFLERFMPSVALFEQASKVIWEDYFPLLRYQILSNPDLTTIYQVNQEMAVRIKEAIKTAQSVEELVELVTTKRYTKARVRRLLTYILVQARENVLPEAIHVLGFTEKVRQHLKSLKGQVNLVSRIGKEPWDAMTQKADQIYQLGKPSIAEQNFGRVPIRIETN

Download

Sequence (FASTA)