Domain assignment for gi|387626924|ref|YP_006063100.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 203 Formyltransferase 4.58e-57 Formyltransferase 0.00000599 1fmt A:1-206 Alignments
205 304 FMT C-terminal domain-like 2.51e-31 Post formyltransferase domain 0.00042 1fmt A:207-314 Alignments

Protein Sequence Details

Sequence length 311
Comment methionyl-tRNA formyltransferase [Streptococcus pneumoniae INV104]
Sequence
MTKLIFMGTPDFSATVLKGLLTDDRYEILAVVTQPDRAVGRKKVIQETPVKQAAKEAGLSIYQPEKLSGSPEMEELMKLGADGIVTAAFGQFLPSKLLDSMDFAVNVHASLLPRHRGGAPIHYALIQGDEEAGVTIMEMVKEMDAGDMISRRSIPITDEDNVGTLFEKLALVGRDLLLDTLPAYIAGDIKPEPQDTSQVTFSPNIKPEEEKLDWNKTNRQLFNQIRGMNPWPVAHTFLKGDRFKIYEALPVEGQGNPGEILSIGKKELIVATAEGALSLKQVQPAGKPKMDIASFLNGVGRTLTVGERFGD

Download

Sequence (FASTA)