Domain assignment for gi|387626912|ref|YP_006063088.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
477 624 Duplicated hybrid motif 3.84e-50 Glucose permease-like 0.00015 1gpr A: Alignments
5 77 Glucose permease domain IIB 1.2e-20 Glucose permease domain IIB 0.0015 1o2f B: Alignments

Protein Sequence Details

Sequence length 627
Comment putative sucrose-specific phosphotransferase system (PTS), IIABC component [Streptococcus pneumoniae INV104]
Sequence
MNNQEIAKKVIDALGGRENVNSVAHCATRLRVMVKDEEKINKEVIENLEKVQGAFFNSGQYQIIFGTGTVNKMYDEVVVLGLPTSSKDDMKAEVAKQGNWFQRAIRTFGDVFVPIIPVIVATGLFMGVRGLFNALEMPLPGDFATYTQILTDTAFIILPGLVVWSTFRVFGGNPAVGIVLGMMLVSGSLPNAWAVAQGGEVTAMNFFGFIPVVGLQGSVLPAFIIGVVGAKFEKAVRKVVPDVIDLLVTPFVTLLVMSILGLFVIGPVFHVVENYILIATKAILSMPFGLGGFLIGGVHQLIVVSGVHHIFNLLEVQLLAADHANPFNAIITAAMTAQGAATVAVGVKTKNPKLKTLAFPAALSAFLGITEPAIFGVNLRFRKPFFLSLIAGAIGGGLASILGLAGTGNGITIIPGTMLYVGNGQLPQYLLMVAVSFALGFALTYMFGYEDEVDATAAAKQAEVAEEKEEVAPAALQNETLVTPIVGDVVALADVNDPVFSSGAMGQGIAVKPSQGVVYALADAEVSIAFPTGHAFGLKTRNGAEVLIHVGIDTVSMNGDGFEAKVAQGNKVKAGDVLGTFDSNKIAAAGLDDTTMVIVTNTADYASVAPVATGSVSKGDAVIEVKI

Download

Sequence (FASTA)