Domain assignment for gi|387626857|ref|YP_006063033.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
37 253 Alpha-L RNA-binding motif 2.36e-31 Ribosomal protein S4 0.053 2gy9 D:2-205 Alignments

Protein Sequence Details

Sequence length 261
Comment hypothetical protein INV104_14130 [Streptococcus pneumoniae INV104]
Sequence
MNKGIYQHFSIEDRPFLDKGMEWIKKVEDSYAPFLTPFINPHQEKLLKILAKTYGLACSSSGEFVSSEYVRVLLYPDYFQPEFSDFEISLQEIVYSNKFEHLTHAKILGTVINQLGIERKLFGDILVDEERAQIMINQQFLLLFQDGLKKIGRIPVSLEERPFTEKIDKLEQYRELDLSVSSFRLDVLLSNVLKLSRNQANQLIEKKLVQVNYHVVDKSDYTVQVGDLISVRKFGRLRLLQDKGQTKKEKKKITVQLLLSK

Download

Sequence (FASTA)