Domain assignment for gi|387626835|ref|YP_006063011.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 126 CheY-like 7.68e-37 CheY-related 0.00057 1nxo A: Alignments
124 222 C-terminal effector domain of the bipartite response regulators 1.98e-25 PhoB-like 0.0033 1qqi A: Alignments

Protein Sequence Details

Sequence length 225
Comment response regulator protein [Streptococcus pneumoniae INV104]
Sequence
MHKILLIEDDQVIRQQIGKMLSEWGFEVVLVEDFMEVLSLFVQSEPHLVLMDIGLPLFNGYHWCQEIRKISKVPIMFLSSRDQAMDIVMAINMGADDFVTKPFDQQVLLAKVQGLLRRSYEFGRDESLLEYAGVILNTKSMDLHYQGQVLNLTKNEFQILRVLFEHAGNIVARDDLMRELWNSDFFIDDNTLSVNVARLRKKLEEQGLVGFIETKKGIGYGLKHA

Download

Sequence (FASTA)