Domain assignment for gi|387626831|ref|YP_006063007.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 89 S15/NS1 RNA-binding domain 1.62e-34 Ribosomal protein S15 0.0000473 1a32 A: Alignments

Protein Sequence Details

Sequence length 89
Comment 30S ribosomal protein S15 [Streptococcus pneumoniae INV104]
Sequence
MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNEHIKQHKKDHATYRGLMKKIGRRRNLLAYLRKNDVNRYRELINSLGLRR

Download

Sequence (FASTA)