Domain assignment for gi|387626826|ref|YP_006063002.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 264 NIF3 (NGG1p interacting factor 3)-like 1.83e-84 NIF3 (NGG1p interacting factor 3)-like 0.000000000192 2fyw A:1-265 Alignments

Protein Sequence Details

Sequence length 265
Comment NIF3 (NGG1p interacting factor 3) family protein [Streptococcus pneumoniae INV104]
Sequence
MLASEVIHAYEAFCPQEFSMEGDSRGLQIGTLDKGIQRVMVALDIREETVAEAIEKGVDLIIVKHAPIFRPIKDLLASRPQNQIYIDLIKHDIAVYVSHTNIDIVENGLNDWFCQMLGIEETTYLQETGPERGIGRIGNIQPQTFWELAQQVKQVFDLDSLRMVHYQENDLQKPISRVAICGGSGQSFYKDALAKGADVYITGDIYYHTAQDMLSDGLLALDPGHYIEVLFVEKIAALLTQWKEKKGWELEILPSQASTNPFRHI

Download

Sequence (FASTA)