Domain assignment for gi|387626803|ref|YP_006062979.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 255 P-loop containing nucleoside triphosphate hydrolases 2.59e-81 ABC transporter ATPase domain-like 0.000000194 1g29 1:1-240 Alignments
248 375 MOP-like 8.02e-27 ABC-transporter additional domain 0.0035 1g29 1:241-301 Alignments

Protein Sequence Details

Sequence length 376
Comment multiple sugar-binding transport ATP-binding protein [Streptococcus pneumoniae INV104]
Sequence
MVELNLKNIYKKYPNSEHYSVEDFNLNIKDKEFIVFVGPSGCGKSTTLRMIAGLEDITEGTASIDGVVVNDVAPKDRDIAMVFQNYALYPHMTVYDNMAFGLKLRKYSKEDINKRVQEAAEILGLKEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVSMRAEIAKIHRRIGATTIYVTHDQTEAMTLADRIVIMSATKNPAGTGTIGRVEQIGTPQEVYKNPVNKFVAGFIGSPAMNFINVKLVGSEIVSDGFRLKVPEGALKVLREKGYEGKELIFGIRPEDVNAEPAFLETFPDCVVKATISVSELLGSESHLYCQVGKDEFVAKVDARDYLQTGATVELGFDLNKAHFFDVETEKTIY

Download

Sequence (FASTA)