Domain assignment for gi|387626797|ref|YP_006062973.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 250 Triosephosphate isomerase (TIM) 4.06e-90 Triosephosphate isomerase (TIM) 0.000000129 2btm A: Alignments

Protein Sequence Details

Sequence length 252
Comment triosephosphate isomerase [Streptococcus pneumoniae INV104]
Sequence
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPALDLTTVLAVAKGSNLKVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFANGMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASVIAYEPIWAIGTGKSASQDDAQKMCKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLEAESFLALLDFVK

Download

Sequence (FASTA)