Domain assignment for gi|387626795|ref|YP_006062971.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
25 166 Ferritin-like 8.86e-41 Ferritin 0.00000197 1umn A: Alignments

Protein Sequence Details

Sequence length 172
Comment Dps-like peroxide resistance protein Dpr [Streptococcus pneumoniae INV104]
Sequence
MVELKKEAVKDVTSLTKAAPVALAKTKEVLNQAVADLYVAHVALHQVHWYMHGRGFLVWHPKMDEYMEALDGQLDEISERLITLGGSPFSTLTEFLQNSEIEEEAGEYRNVEESLERVLVIYRYLSELFQKGLDVTDEEGDDVTNGIFAGAKTETDKTIWMLAAELGQAPGL

Download

Sequence (FASTA)