Domain assignment for gi|387626790|ref|YP_006062966.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 125 YjgF-like 1.57e-46 YjgF/L-PSP 0.0000302 1j7h A: Alignments

Protein Sequence Details

Sequence length 126
Comment endoribonuclease L-PSP family protein [Streptococcus pneumoniae INV104]
Sequence
MAKTIHTDKAPKAIGPYVQGKIVGNLLFASGQVPLSPETGEIVGENIQEQTEQVLKNIGAILAEAGTDFDHVVKTTCFLSDMNDFVPFNEVYQTAFKEEFPARSAVEVARLPRDVKVEIEVIAEIG

Download

Sequence (FASTA)