Domain assignment for gi|387626782|ref|YP_006062958.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 124 SecB-like 3.6e-52 SP1558-like 0.000000263 2hng A:5-128 Alignments

Protein Sequence Details

Sequence length 124
Comment hypothetical protein INV104_13310 [Streptococcus pneumoniae INV104]
Sequence
MNLKREQEFVSQYHFDARNFEWENENGAPETKVDVNFQLLQHDQENQVTSLIVILSFMIVFDKFVISGTISQVNHIDGRIVNEPSELNQEEVETLARPCLNMLNRLTYEVTEIALDLPGINLEF

Download

Sequence (FASTA)