Domain assignment for gi|387626758|ref|YP_006062934.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 75 GIY-YIG endonuclease 0.0000000000000458 GIY-YIG endonuclease 0.015 1mk0 A: Alignments

Protein Sequence Details

Sequence length 99
Comment hypothetical protein INV104_13070 [Streptococcus pneumoniae INV104]
Sequence
MDHKAYMYVLECRDGSYYIGYTTDMRRRLAIHNSGKGAKYTRARLPVKLIYAQGFASKEEAMSAEALFKRKKRPQKEEFLSENQDRNLLSYFEESWGVL

Download

Sequence (FASTA)