Domain assignment for gi|387626757|ref|YP_006062933.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 309 DHH phosphoesterases 9.55e-83 Manganese-dependent inorganic pyrophosphatase (family II) 0.0000000000981 1k20 A: Alignments

Protein Sequence Details

Sequence length 311
Comment manganese-dependent inorganic pyrophosphatase [Streptococcus pneumoniae INV104]
Sequence
MSKILVFGHQNPDSDAIGSSVAFAYLAKEAYGLDTEAVALGTPNEETAFVLNYFGVEAPRVITSAKAEGAEQVILTDHNEFQQSVSDIAEVEVYGVVDHHRVANFETASPLYMRLEPVGSASSIVYRMFKEHGVAVPKEIAGLMLSGLISDTLLLKSPTTHPTDKIIAPELAELAGVNLEEYGLAMLKAGTNLASKSAEELIDIDAKTFELNGNNVRVAQVNTVDIAEVLERQAEIEAAMQAANESNGYSDFVLMITDIVNSNSEILALGANMDKVEAAFNFKLENNHAFLAGAVSRKKQVVPQLTESFNA

Download

Sequence (FASTA)