Domain assignment for gi|387626747|ref|YP_006062923.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
90 296 MurD-like peptide ligases, catalytic domain 1.06e-54 MurCDEF 0.00066 1p3d A:107-321 Alignments
297 431 MurD-like peptide ligases, peptide-binding domain 1.28e-36 MurCDEF C-terminal domain 0.00058 1p3d A:322-473 Alignments
3 89 MurCD N-terminal domain 4.51e-19 MurCD N-terminal domain 0.0007 1p3d A:11-106 Alignments

Protein Sequence Details

Sequence length 444
Comment UDP-N-acetylmuramate--L-alanine ligase [Streptococcus pneumoniae INV104]
Sequence
MSKTYHFIGIKGSGMSALALMLHQMGHKVQGSDVEKYYFTQRGLEQAGITILPFDEKNLDGDMEIIAGNAFRPDNNVEIAYADQNGISYKRYHEFLGSFMRDFVSMGVAGAHGKTSTTGMLSHVLSHITDTSFLIGDGTGRGSANAKYFVFESDEYERHFMPYHPEYSIITNIDFDHPDYFTSLEDVFNAFNDYAKQITKGLFVYGEDAELRKITSDAPIYYYGFEAEGNDFVASDLLRSTTGSTFTVHFRGQNLGQFHIPTFGRHNIMNATAVIGLLYTAGFDLNLVREHLKTFSGVKRRFTEKIVNDTVIIDDFAHHPTEIIATLDAARQKYPSKEIVAVFQPHTFTRTIALLDDFAHALNQADAVYLAQIYGSAREVDHGDVKVEDLANKINKKHQVITVENVSPLLDHDNAVYVFMGAGDIQTYEYSFERLLSNLTSNVQ

Download

Sequence (FASTA)