Domain assignment for gi|387626746|ref|YP_006062922.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
5 135 Acyl-CoA N-acyltransferases (Nat) 3.6e-20 N-acetyl transferase, NAT 0.0089 2ae6 A:1-161 Alignments

Protein Sequence Details

Sequence length 154
Comment acetyltransferase, gnat family protein. acetyltransferase, gnat family protein [Streptococcus pneumoniae INV104]
Sequence
MEIPIKIIQASKSDLPEIGALQTSSFPAEKQQLSHILEESIRKCADTFLLARDENQLLGYILSSPQSDNPQYLKVHSLVIESDHQRQGLGTLLLAALKEVAVDLDYKGIRLESPDELLSYFEMNGFVDEEATLLYATSQGYSMIWFNPFYLEEQ

Download

Sequence (FASTA)