Domain assignment for gi|387626742|ref|YP_006062918.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
33 142 Acyl-CoA N-acyltransferases (Nat) 1.93e-24 N-acetyl transferase, NAT 0.0011 1y9w A:1-140 Alignments

Protein Sequence Details

Sequence length 142
Comment putative acetyltransferase [Streptococcus pneumoniae INV104]
Sequence
MFYFISLYFRLENKESHKSQEIGNLIRVYNRSKREEAESEPLNLYVEDEKGNLLAGLIAETFGNWLQIEYLFVKEELRGQGIGSKLLQQAESEAKNRNCCFAFVNTYQFQAPDFYQKHGYKEVFSLQDYLYIRQRYYYQKNL

Download

Sequence (FASTA)