Domain assignment for gi|387626740|ref|YP_006062916.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 65 F1F0 ATP synthase subunit C 0.000000000000127 F1F0 ATP synthase subunit C 0.0045 1c99 A: Alignments

Protein Sequence Details

Sequence length 66
Comment ATP synthase subunit C [Streptococcus pneumoniae INV104]
Sequence
MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLVFSFIIK

Download

Sequence (FASTA)