Domain assignment for gi|387626739|ref|YP_006062915.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
72 229 F1F0 ATP synthase subunit A 7.98e-35 F1F0 ATP synthase subunit A 0.0015 1c17 M: Alignments

Protein Sequence Details

Sequence length 238
Comment ATP synthase subunit A [Streptococcus pneumoniae INV104]
Sequence
MEESINPIISIGPVIFNLTMLAMTLLIVGVIFVFIYWASRNMTLKPKGKQNVLEYVYDFVIGFTEPNIGSRYMKDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLTLSFLVILLTHIESVRRRGFKKSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEVMTSLLLLLSHQAIYWYPVAFGANLAWTAFSVFISCIQAYVFTLLTSVYLGNKINIEEE

Download

Sequence (FASTA)