Domain assignment for gi|387626737|ref|YP_006062913.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
5 102 N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.0000000000000011 N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.0063 1abv A: Alignments

Protein Sequence Details

Sequence length 178
Comment putative ATP synthase delta chain [Streptococcus pneumoniae INV104]
Sequence
MDKKTVKVIEKYSMPFVQLVLEKGEEDRIFSDLTQIKQVVEKTGLPSFLKQVAVDESDKEKTIAFFQDSVSPLLQNFIQVLAYNHRANLFYDVLVDCLNRLEKETNRFEVTITSAHPLTDEQKTRLLPLIEKKMSLKVRSVKEQIDESLIGGFVIFANHKTIDVSIKQQLKVVKENLK

Download

Sequence (FASTA)