Domain assignment for gi|387626725|ref|YP_006062901.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
26 236 Phosphoglucomutase, first 3 domains 2.43e-45 Phosphoglucomutase, first 3 domains 0.0015 1k2y X:5-154 Alignments
304 454 Phosphoglucomutase, first 3 domains 7.06e-30 Phosphoglucomutase, first 3 domains 0.0044 1kfi A:324-443 Alignments
227 311 Phosphoglucomutase, first 3 domains 1.06e-18 Phosphoglucomutase, first 3 domains 0.0055 1k2y X:155-258 Alignments
467 562 Phosphoglucomutase, C-terminal domain 6.15e-17 Phosphoglucomutase, C-terminal domain 0.008 3pmg A:421-561 Alignments

Protein Sequence Details

Sequence length 572
Comment putative phosphomannomutase [Streptococcus pneumoniae INV104]
Sequence
MSYQENYQKWVDFVELPDYLRQDLENMDEKTKEDAFYTNLEFGTAGMRGLVGAGTNRINIYVVRQATEGLARLIESKGGNEKERGVAIAYDSRHFSPEFAFESAAVLAKHGIKSYVFESLRPTPELSFAVRHLNCFAGIMVTASHNPAPFNGYKVYGEDGGQMPPHDADALTTYIRAIENPFAVEVADVETEKASGLIEVIGEAVDVEYLKEVKDVNINPALIEEFGKDMKIVYTPLHGTGEMLARRALAQAGFDSVQVVEAQATADPDFSTVTSPNPESQAAFALAEELGRQVGADVLVATDPDADRVGVEVLQKDGSYLNLSGNQIGAIMAKYILEAHKNAGTLPENAALCKSIVSTDLVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMMGFEESFGYLIKPFVRDKDAIQAVLVVAELAAYYRSRGLTLADGIEEIYKEYGYYAEKTISVTLSGVDGAEQIKAIMAKFRNNAPTEWNATAITVVEDFKAQTATVADGTVTNLTTPPSDVLKYTLADGSWIAVRPSGTEPKIKFYIAVVGETNEESQAKIANIEAEINAFVK

Download

Sequence (FASTA)