Domain assignment for gi|387626702|ref|YP_006062878.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 155 Acyl-CoA N-acyltransferases (Nat) 1.36e-20 N-acetyl transferase, NAT 0.0083 2fia A:1-157 Alignments

Protein Sequence Details

Sequence length 164
Comment acetyltransferase (GNAT) family protein [Streptococcus pneumoniae INV104]
Sequence
MEIRLAFPNEVDAIMQVMEDAKKCLADAGSDQWQNGYPNADVIIDDIISGQAYVALEEGELLAYAAVTKSPEEAYEAIYEGNWQAGESEYLVFHRIAVAADVQGKGVAQTFLEGLIEGFDYLDFRSDTHAENKVMQHIFEKLGFKQVGKVPVDGERLAYQKLKK

Download

Sequence (FASTA)