Domain assignment for gi|387626701|ref|YP_006062877.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
82 164 Methylated DNA-protein cysteine methyltransferase, C-terminal domain 1.44e-27 Methylated DNA-protein cysteine methyltransferase, C-terminal domain 0.00022 1mgt A:89-169 Alignments
6 88 Methylated DNA-protein cysteine methyltransferase domain 0.00000000000153 Methylated DNA-protein cysteine methyltransferase domain 0.019 1qnt A:6-91 Alignments

Protein Sequence Details

Sequence length 170
Comment putative methylated-DNA--protein-cysteine methyltransferase [Streptococcus pneumoniae INV104]
Sequence
MQKKYVKILYSSPIGILSLVADDHYLYGIWVQEQKHFERGLGDETIEEVVSHPILDPVIACLDDYFKGKPQDLSNLLLAPIGTNFEKRVWDYLQGIPYGQTVTYGQIAQDLQVASAQAIGGAVGRNPWSILVPCHRVLGAGKRLTGYAAGVEKKAWLLEHEGVDFKDINK

Download

Sequence (FASTA)