Domain assignment for gi|387626659|ref|YP_006062834.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 69 BH2638-like 5.62e-25 BH2638-like 0.00097 2oy9 A:6-90 Alignments

Protein Sequence Details

Sequence length 72
Comment hypothetical protein INV104_11970 [Streptococcus pneumoniae INV104]
Sequence
MLSFFNDVEAAYEGKVEAKKLLDSYKGFKAVVPSKSEEKRLGREFETVSGYSLYRAVQAAKEKGKGKISLEK

Download

Sequence (FASTA)