Domain assignment for gi|387626645|ref|YP_006062820.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
5 248 P-loop containing nucleoside triphosphate hydrolases 3.28e-85 ABC transporter ATPase domain-like 0.00000162 1g29 1:1-240 Alignments
240 345 MOP-like 0.00000000000289 ABC-transporter additional domain 0.025 1v43 A:246-299 Alignments

Protein Sequence Details

Sequence length 385
Comment putative spermidine/putrescine ABC transporter ATP-binding protein [Streptococcus pneumoniae INV104]
Sequence
MKKPIIEFKNVSKVFEDSNTKVLKDINFELEEGKFYTLLGASGSGKSTILNIIAGLLDATTGDIMLDGVRINDIPTNKRDVHTVFQSYALFPHMNVFENVAFPLRLRKIDKKEIEQRVAEVLKMVQLEGYEKRSIRKLSGGQRQRVAIARAIINQPRVVLLDEPLSALDLKLRTDMQYELRELQQRLGITFVFVTHDQEEALAMSDWIFVMNDGEIVQSGTPVDIYDEPINHFVATFIGESNILPGTMIEDYLVEFNGKRFEAVDGGMKPNEPVEVVIRPEDLRITLPEEGKLQVKVDTQLFRGVHYEIIAYDELGNEWMIHSTRKAIVGEEIGLDFESEDIHIMRLNETEEEFDARIEEYVEIEEQEAGLINAIEEERDEENKL

Download

Sequence (FASTA)