Domain assignment for gi|387626631|ref|YP_006062806.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 110 YheA/YmcA-like 3.53e-30 YheA-like 0.00000198 2iaz A:1-111 Alignments

Protein Sequence Details

Sequence length 112
Comment hypothetical protein INV104_11680 [Streptococcus pneumoniae INV104]
Sequence
MSNIYDSANELSRGLRGLPEYKAVKAAKDAIAADAEASKIFTEYLAFQEEIQKLAQTGQMPDASFQAKMEGFGKQIQGNSLLSEFFTKQQQLAIYLSDIEKIVFEPVSELLK

Download

Sequence (FASTA)